PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.07BW1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 364aa    MW: 41410.1 Da    PI: 6.9807
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.07BW1genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  ++++G g+W+++++  g+ R++k+c++rw +yl
      Araip.07BW1 14 KGLWSPEEDEKLLMHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding44.34.3e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE+ l+++++  lG++ W+ Ia+ ++ gRt++++k+ w++
      Araip.07BW1  67 RGTFSQEEENLIIELHGVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-28664IPR009057Homeodomain-like
PROSITE profilePS5129417.924961IPR017930Myb domain
SuperFamilySSF466892.57E-2912108IPR009057Homeodomain-like
SMARTSM007171.2E-121363IPR001005SANT/Myb domain
PfamPF002499.0E-151461IPR001005SANT/Myb domain
CDDcd001675.52E-111761No hitNo description
PROSITE profilePS5129425.3962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2565116IPR009057Homeodomain-like
SMARTSM007171.1E-1266114IPR001005SANT/Myb domain
PfamPF002496.6E-1367111IPR001005SANT/Myb domain
CDDcd001679.86E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MRRHSCCYNQ KLRKGLWSPE EDEKLLMHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIIE LHGVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKKIP EAEKGSGGED NDNRNQEKTA EASSNELNKS DDATPYVQNR ASSMSCHHHS  180
DFMGGFPIQM INHASSSSDS NSVNWYSHSS GRSFDINTDF PFNTTSILTP TTATNLFLPT  240
DSSFLYKPSF SSSSNSPENI SNTAPYGLKE EQYQIHMSIE ELEELSSKWD EYYYYLHNPV  300
SMLASSESFC NEIKPDIHHL VPDTPGPIML PHHNNNNTKF QEPSQMASFF SKDIQKLTAA  360
FGHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29121165108B-MYB
1h8a_C8e-29311616128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0973261e-112BT097326.1 Soybean clone JCVI-FLGm-21J24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016174129.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A0B2NT941e-134A0A0B2NT94_GLYSO; Transcription factor MYB86
TrEMBLK7K5T61e-134K7K5T6_SOYBN; Uncharacterized protein
STRINGGLYMA02G00960.21e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.38e-89myb domain protein 55